anti-ACTH antibody product blog
Tags: Antibody; ACTH; Polyclonal Antibody; anti-ACTH antibody;
The ACTH n/a (Catalog #MBS540945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTH Antibody BIOTIN-Conjugated reacts with Human, Mouse, RatPredicted: Chicken, Chimpanzee, Cow, Dog, Goat, Guinea pig, Macaque Monkey, Orangutan, Sheep and may cross-react with other species as described in the data sheet. MyBioSource\'s ACTH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Formalin/Paraffin, Immunoprecipitation (IP), Western Blot (WB).
Confocal Microscopy: 1:250
Immunocytochemistry: 1:250
Immunofluorescence: 1:200
Immunohistochemistry: 1:250
Immunoprecipitation: 1:200
Western Blot: 1:1,000. Researchers should empirically determine the suitability of the ACTH n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The ACTH n/a product has the following accession number(s) (GI #60829907) (NCBI Accession #AAX36901). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
BIOTIN-Conjugated Adrenocorticotropin Hormone Antibody
Stimulates adrenal glands and release cortisol.
Immunogen: Synthetic peptide corresponding to ACTH aa 138-176.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Expression: ACTH and MSH are produced by the pituitary gland. Molecular Function: GPCR; Hormone activity
Structure: Belongs to POMC family
Subcellular Location: Secreted. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing ACTH are readily searchable from our website. Different antibodies against the same target such as ACTH may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.