anti-APH1A antibody product blog
Tags: Antibody; Polyclonal Antibody; anti-APH1A antibody; APH1A;
The APH1A aph1a (Catalog #MBS178259) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-APH1a Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s APH1a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the APH1A aph1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The APH1A aph1a product has the following accession number(s) (GI #117606362) (NCBI Accession #NP_001071096.1) (Uniprot Accession #Q96BI3). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Anti-APH1a Antibody with the following immunoassay(s):
Western Blot (WB) (Anti- APH1a Picoband antibody, MBS178259, Western blotting
All lanes: Anti APH1a (MBS178259) at 0.5ug/ml
Lane 1: Mouse Lung Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Lane 5: Human Placenta Tissue Lysate at 50ug
Predicted bind size: 29KD
Observed bind size: 29KD )
Description: Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1(APH1A) detection. Tested with WB in Human;Mouse.
Background: APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer\'s disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.
Ig Type: Rabbit IgG. Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing APH1A are readily searchable from our website. Different antibodies against the same target such as APH1A may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.