anti-ASXL2 antibody product blog
Tags: Antibody; Polyclonal Antibody; ASXL2; anti-ASXL2 antibody;
The ASXL2 n/a (Catalog #MBS5302369) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s ASXL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the ASXL2 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The ASXL2 n/a product has the following accession number(s) (GI #649141631) (NCBI Accession #AIC60320.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the ASXL2 antibody with the following immunoassay(s):
Western Blot (WB) (ASXL2 antibody (MBS5302369) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal ASXL2 antibody.
Biological Significance: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing. Cross-Reactivity: Human
Immunogen: ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing ASXL2 are readily searchable from our website. Different antibodies against the same target such as ASXL2 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.