Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-Beta Tubulin 2A antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-SLITRK4 antibody blog
 • anti-APOA1 antibody blog
 • anti-EPM2A antibody blog
 • anti-GOSR1 antibody blog
 • anti-IKBKAP antibody blog
 • anti-USP8 antibody blog
 • anti-HB antibody blog
 • anti-LYZ antibody blog
 • anti-HSP22 antibody blog
 • anti-SORBS3 antibody blog
 • anti-PPIF antibody blog
 • anti-SERPINB3 antibody blog
 • anti-SYT10 antibody blog
 • anti-Oxycodone (N) antibody blog
 • anti-AhR antibody blog
 • anti-C15orf39 antibody blog
 • anti-PTPN1 antibody blog
 • anti-HCK antibody blog
 • anti-MAP Kinase, p38 antibody blog
 • anti-MDM4 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • Tumor Type M2 Pyruvate Kinase (M2PK) Antibody
 • ABCG1 Antibody
 • SAA Antibody
 • Connective Tissue Growth Factor (CTGF) ELISA Kit
 • mCherry Antibody
 • fibroblast growth factor 1 (acidic) (FGF1) ELISA Kit
 • Myeloperoxidase (MPO) ELISA Kit
 • DPF2 Antibody
 • Streptococcus pneumoniae Common C-polysaccharide Antibody
 • Actin, cytoplasmic 1 (ACTB) Recombinant Protein
 • KRT14 - CK14 - Cytokeratin 14 Antibody
 • CD340 (ErbB2) Antibody
 • Inhibin B (INHB) ELISA Kit
 • Interleukin-15 (rIL 15) Recombinant Protein
 downarrow more ...
separator

anti-Beta Tubulin 2A antibody product blog

separator
Posted on 2016-01-04 14:17:50 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; Beta Tubulin 2A; anti-Beta Tubulin 2A antibody;
separator
The Beta Tubulin 2A n/a (Catalog #MBS5301968) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Beta Tubulin 2A antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Beta Tubulin 2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the Beta Tubulin 2A n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Beta Tubulin 2A antibody with the following immunoassay(s):
Western Blot (WB) (Beta Tubulin 2A antibody (MBS5301968) used at 1 ug/ml to detect target protein.)
Western Blot (WB) Beta Tubulin 2A.

Rabbit polyclonal Beta Tubulin 2A antibody raised against the N terminal of TUBB2A.

Biological Significance: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Immunogen: Beta Tubulin 2A antibody was raised using the N terminal of TUBB2A corresponding to a region with amino acids MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Beta Tubulin 2A are readily searchable from our website. Different antibodies against the same target such as Beta Tubulin 2A may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions