anti-BMP2K antibody product blog
Tags: Antibody; Polyclonal Antibody; anti-BMP2K antibody; BMP2K;
The BMP2K bmp2k (Catalog #MBS5300754) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP2K antibody reacts with Human, Dog and may cross-react with other species as described in the data sheet. MyBioSource\'s BMP2K can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC).WB: 5 ug/ml
IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the BMP2K bmp2k for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The BMP2K bmp2k product has the following accession number(s) (GI #38787935) (NCBI Accession #NP_942595.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the BMP2K antibody with the following immunoassay(s):
Western Blot (WB) (BMP2K antibody (MBS5300754) used at 5 ug/ml to detect target protein.)
Immunohistochemistry (IHC) (BMP2K antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
Rabbit polyclonal BMP2K antibody raised against the C terminal of BMP2K.
Biological Significance: BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Cross-Reactivity: Human,Dog
Immunogen: BMP2K antibody was raised using the C terminal of BMP2K corresponding to a region with amino acids �AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing BMP2K are readily searchable from our website. Different antibodies against the same target such as BMP2K may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. The following patways have been known to be associated with this gene. Bone, Eye, Kidney tissues are correlated with this protein. BMP2K also interacts with the following gene(s): EPS15, NUMB.