Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-C10ORF83 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
 • anti-Ezh1 antibody blog
 • anti-CETP antibody blog
 • anti-HSD3B7 antibody blog
 • anti-ADRA2C antibody blog
 • anti-UBE2I antibody blog
 • anti-IRAK4 antibody blog
 • anti-MED17 antibody blog
 • anti-DOK1 antibody blog
 • anti-RASA1 antibody blog
 • anti-FG antibody blog
 • anti-IFNG antibody blog
 • anti-SCAMP4 antibody blog
 • anti-GNL3L antibody blog
 • anti-GPR32 antibody blog
 • anti-PlGF-1 antibody blog
 • anti-ZEB1 antibody blog
 • anti-PGBD5 antibody blog
 • anti-CRHR1 antibody blog
 • anti-PIK3CD antibody blog
 • anti-MECP2 antibody blog
Blog Categories separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
Our Best Sellers moreseparator
 • ARPC5 Recombinant Protein
 • GRO-KC (mGRO1-KC) Recombinant Protein
 • Insulin Recombinant Protein
 • RPRD1B Antibody
 • Acinetobacter baumannii (strain ATCC 17978 - NCDC KC 755) Ou... Recombinant Protein
 • interleukin 5 receptor, alpha (IL5RA) Antibody
 • ZASP- CYPHER-LDB3 Antibody
 • CD107a (LAMP-1) Antibody
 • Tumor necrosis factor ligand superfamily member 11 (TNFSF11) ELISA Kit
 • KLK2 Peptide
 • IL-5 (IL5) Antibody
 • BFP Antibody
 • 8-oxoguanine DNA glycosylase (OGG1) ELISA Kit
 downarrow more ...

anti-C10ORF83 antibody product blog

Posted on 2016-01-14 16:12:29 by mybiosource_staff
Share it on ...     
Tags: Antibody; Polyclonal Antibody; C10ORF83; anti-C10ORF83 antibody;
The C10ORF83 morn4 (Catalog #MBS5300155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C10ORF83 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s C10ORF83 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the C10ORF83 morn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The C10ORF83 morn4 product has the following accession number(s) (GI #119570296) (NCBI Accession #EAW49911.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:

Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the C10ORF83 antibody with the following immunoassay(s):
Western Blot (WB) (C10ORF83 antibody (MBS5300155) used at 1 ug/ml to detect target protein.)
Western Blot (WB) C10ORF83.

Rabbit polyclonal C10ORF83 antibody raised against the middle region of C10Orf83.

Biological Significance: The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated. Immunogen: C10ORF83 antibody was raised using the middle region of C10Orf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing C10ORF83 are readily searchable from our website. Different antibodies against the same target such as C10ORF83 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. C10ORF83 also interacts with the following gene(s): MYO3A, MYO3B. Neurotoxicity Syndromes, Poisoning are some of the diseases may be linked to C10ORF83 antibody. Eye tissues are correlated with this protein.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions