Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-C10ORF83 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-MALT-1 antibody blog
 • anti-MTBE antibody blog
 • anti-LRP8 antibody blog
 • anti-ctcf antibody blog
 • anti-MIB2 antibody blog
 • anti-ITGA2B antibody blog
 • anti-CDKN2A antibody blog
 • anti-Iah1 antibody blog
 • anti-SESTD1 antibody blog
 • anti-SELP antibody blog
 • anti-NKX2-5 antibody blog
 • anti-MYOM1 antibody blog
 • anti-ZP3 antibody blog
 • anti-CRYbB1 antibody blog
 • anti-IL4 antibody blog
 • anti-MAP2K4 antibody blog
 • anti-IFI44L antibody blog
 • anti-COMT antibody blog
 • anti-M6PR antibody blog
 • anti-ZFAND6 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • synuclein, gamma (breast cancer-specific protein 1) (SNCG) ELISA Kit
 • Collectin-11 (COLEC11) ELISA Kit
 • Epstein-Barr Virus (EBV)(HHV-4) Early Antigen D (EA-D) Recom... Recombinant Protein
 • ABCC3 Antibody
 • CTRP10, globular domain Recombinant Protein
 • Chaperonin 10 (CPN10) ELISA Kit
 • SERTAD1 Antibody
 • Adapter protein CIKS (TRAF3IP2) ELISA Kit
 • 5-Alpha Reductase - SRD5A1 Antibody
 • galectin-3 (Lgals3) Antibody
 • Estrogen Receptor, beta (ESR1) Antibody
 • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase,... Antibody
 • SRD5A2 Peptide
 • Troponin I, fast skeletal muscle (TNNI2) ELISA Kit
 downarrow more ...
separator

anti-C10ORF83 antibody product blog

separator
Posted on 2016-01-14 16:12:29 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; C10ORF83; anti-C10ORF83 antibody;
separator
The C10ORF83 morn4 (Catalog #MBS5300155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C10ORF83 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s C10ORF83 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the C10ORF83 morn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The C10ORF83 morn4 product has the following accession number(s) (GI #119570296) (NCBI Accession #EAW49911.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the C10ORF83 antibody with the following immunoassay(s):
Western Blot (WB) (C10ORF83 antibody (MBS5300155) used at 1 ug/ml to detect target protein.)
Western Blot (WB) C10ORF83.

Rabbit polyclonal C10ORF83 antibody raised against the middle region of C10Orf83.

Biological Significance: The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated. Immunogen: C10ORF83 antibody was raised using the middle region of C10Orf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing C10ORF83 are readily searchable from our website. Different antibodies against the same target such as C10ORF83 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Neurotoxicity Syndromes, Poisoning are some of the diseases may be linked to C10ORF83 antibody. C10ORF83 also interacts with the following gene(s): MYO3A, MYO3B. Eye tissues are correlated with this protein.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions