anti-C16ORF65 antibody product blog
Tags: Antibody; Polyclonal Antibody; C16ORF65; anti-C16ORF65 antibody;
The C16ORF65 pdzd9 (Catalog #MBS5302604) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s C16ORF65 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the C16ORF65 pdzd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The C16ORF65 pdzd9 product has the following accession number(s) (GI #112180731) (NCBI Accession #AAH21724.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the C16ORF65 antibody with the following immunoassay(s):
Western Blot (WB) (C16ORF65 antibody (MBS5302604) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal C16ORF65 antibody raised against the middle region of C16Orf65.
Biological Significance: The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully. Cross-Reactivity: Human
Immunogen: C16ORF65 antibody was raised using the middle region of C16Orf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing C16ORF65 are readily searchable from our website. Different antibodies against the same target such as C16ORF65 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.