anti-C2orf25 antibody product blog
Tags: Antibody; Polyclonal Antibody; C2ORF25; anti-C2ORF25 antibody;
The C2orf25 mmadhc (Catalog #MBS5301606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s C2orf25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the C2orf25 mmadhc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The C2orf25 mmadhc product has the following accession number(s) (GI #119631942) (NCBI Accession #EAX11537.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the C2orf25 antibody with the following immunoassay(s):
Western Blot (WB) (C2orf25 antibody (MBS5301606) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal C2orf25 antibody.
Biological Significance: Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism. Cross-Reactivity: Human
Immunogen: C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing C2orf25 are readily searchable from our website. Different antibodies against the same target such as C2orf25 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Fetal Growth Retardation, Heart Diseases, Hepatomegaly are some of the diseases may be linked to C2orf25 antibody. C2orf25 also interacts with the following gene(s): ABCD4, LMBRD1, MMAA, MMAB, MMACHC, MTR, MTRR, MUT. The following patways have been known to be associated with this gene. Blood, Embryonic Tissue, Heart, Kidney, Liver, Lung, Nerve, Skin tissues are correlated with this protein.