Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-C3HC4 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-AKR1C4 antibody blog
 • anti-BIN3 antibody blog
 • anti-GRM1 antibody blog
 • anti-ASTL antibody blog
 • anti-CYR61 antibody blog
 • anti-ACADM antibody blog
 • anti-TXLNA antibody blog
 • anti-WARS antibody blog
 • anti-CAT antibody blog
 • anti-HRH3 antibody blog
 • anti-heat shock protein 70kDa family, member 13 antibody blog
 • anti-DPP9 antibody blog
 • anti-SEMA3A antibody blog
 • anti-KAP1 antibody blog
 • anti-NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 antibody blog
 • anti-RAD antibody blog
 • anti-IFNAR2 antibody blog
 • anti-Net antibody blog
 • anti-STAP2 antibody blog
 • anti-BACE2 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • Cofilin 1 (CFL1) Antibody
 • Janus Kinase 1 (JAK1) Recombinant Protein
 • Von Willebrand Factor cleaving protease (ADAMTS13-vWF-cp) ELISA Kit
 • A Disintegrin and Metalloprotease 10 (ADAM10) ELISA Kit
 • CD44 Antibody
 • TRYPTOPHAN HYDROXYLASE (TPH1) Antibody
 • Thyroglobulin (TG) Native Protein
 • Fatty Acid Binding Protein 1, Liver (FABP1) Antibody
 • Glutamate Dehydrogenase (GLDH) Enzyme
 • NT-proBNP ELISA Kit
 • Anti-Histone Antibody (AHA) ELISA Kit
 • ApoA4 Antibody
 • tumor necrosis factor (TNF superfamily, member 2) ELISA Kit
 • cat eye syndrome chromosome region, candidate 9 (CECR9) ELISA Kit
 downarrow more ...
separator

anti-C3HC4 antibody product blog

separator
Posted on 2015-12-08 12:39:17 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; C3HC4; anti-C3HC4 antibody;
separator
The C3HC4 n/a (Catalog #MBS839420) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3HC4 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s C3HC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the C3HC4 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the C3HC4 antibody with the following immunoassay(s):
Western Blot (WB) (C3HC4 antibody (MBS839420) used at 1 ug/ml to detect target protein.)
Western Blot (WB) C3HC4.

Rabbit polyclonal C3HC4 antibody.

Biological Significance: MARCH2 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. MARCH2 may be involved in endosomal trafficking through interaction with STX6. Immunogen: C3HC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing C3HC4 are readily searchable from our website. Different antibodies against the same target such as C3HC4 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions