anti-CLDN15 antibody product blog
Tags: Antibody; Polyclonal Antibody; CLDN15; claudin 15; anti-CLDN15 antibody;
The CLDN15 cldn15 (Catalog #MBS5301053) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s Claudin 15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the CLDN15 cldn15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The CLDN15 cldn15 product has the following accession number(s) (GI #297515455) (NCBI Accession #NP_001172009.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Claudin 15 antibody with the following immunoassay(s):
Western Blot (WB) (Claudin 15 antibody (MBS5301053) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal Claudin 15 antibody raised against the middle region of CLDN15.
Biological Significance: CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Cross-Reactivity: Human
Immunogen: Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing CLDN15 are readily searchable from our website. Different antibodies against the same target such as CLDN15 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Blood, Brain, Intestine, Lung, Stomach, Thyroid tissues are correlated with this protein. Breast Neoplasms, Carcinoma, Death, Liver Diseases, Liver Neoplasms, Lung Diseases, Lung Neoplasms are some of the diseases may be linked to Claudin 15 antibody. CLDN15 also interacts with the following gene(s): CLDN12, CLDN17, CLDN23, CLDN9. The following patways have been known to be associated with this gene.