anti-CPNE9 antibody product blog
Tags: Antibody; Polyclonal Antibody; CPNE9; Copine IX; anti-CPNE9 antibody;
The CPNE9 cpne9 (Catalog #MBS839674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Copine IX antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Copine IX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the CPNE9 cpne9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The CPNE9 cpne9 product has the following accession number(s) (GI #88703066) (NCBI Accession #NP_705899.2). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Copine IX antibody with the following immunoassay(s):
Western Blot (WB) (Copine IX antibody (MBS839674) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal Copine IX antibody raised against the middle region of CPNE9.
Biological Significance: CPNE9 may function in membrane trafficking. It exhibits calcium-dependent phospholipid binding properties. Cross-Reactivity: Human,Mouse,Rat
Immunogen: Copine IX antibody was raised using the middle region of CPNE9 corresponding to a region with amino acids YDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKC. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing CPNE9 are readily searchable from our website. Different antibodies against the same target such as CPNE9 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.