anti-EDAR antibody product blog
Tags: Antibody; Polyclonal Antibody; ectodysplasin A receptor; anti-EDAR antibody; EDAR;
The EDAR edar (Catalog #MBS5302636) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ectodysplasin A Receptor antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Ectodysplasin A Receptor can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the EDAR edar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The EDAR edar product has the following accession number(s) (GI #62739796) (NCBI Accession #AAH93872.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Ectodysplasin A Receptor antibody with the following immunoassay(s):
Western Blot (WB) (Ectodysplasin A Receptor antibody (MBS5302636) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal Ectodysplasin A Receptor antibody raised against the middle region of EDAR.
Biological Significance: EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. Cross-Reactivity: Human,Mouse,Rat
Immunogen: Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing EDAR are readily searchable from our website. Different antibodies against the same target such as EDAR may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. EDAR also interacts with the following gene(s): CYLD, EDA, EDARADD, FADD, SLC24A5, SLC45A2, TRADD, TRAF2, TRAF3. Chromosome Aberrations, Ectodermal Dysplasia, Hypohidrotic, Autosomal Recessive, Fetal Death, Inflammation, Necrosis, Nervous System Diseases, Neurologic Manifestations, Pigmentation Disorders, Respiratory Tract Diseases, Skin Diseases are some of the diseases may be linked to Ectodysplasin A Receptor antibody. Brain, Embryonic Tissue, Heart, Kidney, Mouth, Prostate, Uncharacterized Tissue tissues are correlated with this protein.