anti-FAM134C antibody product blog
Tags: Antibody; Polyclonal Antibody; FAM134C; anti-FAM134C antibody;
The FAM134C n/a (Catalog #MBS839074) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM134C antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s FAM134C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the FAM134C n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The FAM134C n/a product has the following accession number(s) (GI #649115199) (NCBI Accession #AIC53303.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the FAM134C antibody with the following immunoassay(s):
Western Blot (WB) (FAM134C antibody (MBS839074) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal FAM134C antibody raised against the N terminal of FAM134C.
Biological Significance: FAM134C belongs to the FAM134 family. Cross-Reactivity: Human,Mouse,Rat
Immunogen: FAM134C antibody was raised using the N terminal of FAM134C corresponding to a region with amino acids EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing FAM134C are readily searchable from our website. Different antibodies against the same target such as FAM134C may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.