anti-FAM82A antibody product blog
Tags: Antibody; Polyclonal Antibody; FAM82A; anti-FAM82A antibody;
The FAM82A rmdn2 (Catalog #MBS5301050) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM82A antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s FAM82A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the FAM82A rmdn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The FAM82A rmdn2 product has the following accession number(s) (GI #119620792) (NCBI Accession #EAX00387.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the FAM82A antibody with the following immunoassay(s):
Western Blot (WB) (FAM82A antibody (MBS5301050) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal FAM82A antibody raised against the middle region of Fam82A.
Biological Significance: FAM82A belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the FAM82A protein remains unknown. Cross-Reactivity: Human,Mouse
Immunogen: FAM82A antibody was raised using the middle region of Fam82A corresponding to a region with amino acids WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing FAM82A are readily searchable from our website. Different antibodies against the same target such as FAM82A may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.