Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-FER1L3 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-AGT antibody blog
 • anti-HSP21 antibody blog
 • anti-LPAR3 antibody blog
 • anti-ANGPTL4 antibody blog
 • anti-HPRT antibody blog
 • anti-HIRIP3 antibody blog
 • anti-TNNI3 antibody blog
 • anti-MB antibody blog
 • anti-APOA1BP antibody blog
 • anti-HADHB antibody blog
 • anti-GPAM antibody blog
 • anti-ICAD antibody blog
 • anti-ACAA1 antibody blog
 • anti-NDUFB7 antibody blog
 • anti-NEDD9 antibody blog
 • anti-HLA-DRB5 antibody blog
 • anti-PLXNB1 antibody blog
 • anti-Quinaldic Acid antibody blog
 • anti-TIA1 antibody blog
 • anti-TGFR3 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • NFkappaB-p105 Antibody
 • RNF34 Antibody
 • K88 minor fimbrial subunit faeH (faeH) Recombinant Protein
 • Dihydrotestosterone, DHT ELISA Kit
 • Diamine Oxidase (DAO) ELISA Kit
 • SART1 Peptide
 • Integrin beta 4 (CD104) (ITGB4) Antibody
 • Neuron Specific Enolase (NSE) ELISA Kit
 • Acetyl Coenzyme A Carboxylase Alpha (ACACA) ELISA Kit
 • IgM (Immunoglobulin Mu Heavy Chain) (IGHM) Antibody
 • Cluster of Differentiation 226 (CD226) ELISA Kit
 • CTGF Antibody
 • Catalase Native Protein
 • Protein A-Poly20 Poly-HRP
 downarrow more ...
separator

anti-FER1L3 antibody product blog

separator
Posted on 2015-10-17 00:50:28 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; FER1L3; anti-FER1L3 antibody;
separator
The FER1L3 n/a (Catalog #MBS839393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FER1L3 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s FER1L3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the FER1L3 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the FER1L3 antibody with the following immunoassay(s):
Western Blot (WB) (FER1L3 antibody (MBS839393) used at 1 ug/ml to detect target protein.)
Western Blot (WB) FER1L3.

Rabbit polyclonal FER1L3 antibody.

Biological Significance: Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Immunogen: FER1L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing FER1L3 are readily searchable from our website. Different antibodies against the same target such as FER1L3 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions