Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-FER1L3 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
 • anti-BUB1 antibody blog
 • anti-USP8 antibody blog
 • anti-YAP1 antibody blog
 • anti-RABEPK antibody blog
 • anti-SCFR antibody blog
 • anti-AT antibody blog
 • anti-MOGS antibody blog
 • anti-pr38a antibody blog
 • anti-GPR52 antibody blog
 • anti-TRAM2 antibody blog
 • anti-C3 antibody blog
 • anti-Cd28 antibody blog
 • anti-DKC1 antibody blog
 • anti-EZH2 antibody blog
 • anti-CXCL14 antibody blog
 • anti-IgA antibody blog
 • anti-SERPINA6 antibody blog
 • anti-U2AF59 antibody blog
 • anti-MAGEB2 antibody blog
 • anti-COL18A1 antibody blog
Blog Categories separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
Our Best Sellers moreseparator
 • Y box binding protein 1 (YBX1) Antibody
 • transforming growth factor, beta-induced, 68kDa (TGFBI) ELISA Kit
 • Fructose-bisphosphate aldolase B (Aldob) Recombinant Protein
 • Fibroblast Growth Factor Receptor-3 (FGFR3) Recombinant Protein
 • CD28 Antibody
 • Antimicrobial peptide lumbricin-1 Recombinant Protein
 • membrane-spanning 4-domains, subfamily A, member 6A (MS4A6A... Antibody
 • MUC16 - CA125 Antibody
 • Polycystin 2 - PKD2 Peptide
 • OATP3 Antibody
 • Tryptase (TPS) ELISA Kit
 • kappa light chain (LOC100037688) Antibody
 • Treponema pallidum, Treponemal membrane Protein A (TmpA)(Syp... Recombinant Protein
 • XBP1 Antibody
 downarrow more ...

anti-FER1L3 antibody product blog

Posted on 2015-10-17 00:50:28 by mybiosource_staff
Share it on ...     
Tags: Antibody; Polyclonal Antibody; FER1L3; anti-FER1L3 antibody;
The FER1L3 n/a (Catalog #MBS839393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FER1L3 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s FER1L3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the FER1L3 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:

Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the FER1L3 antibody with the following immunoassay(s):
Western Blot (WB) (FER1L3 antibody (MBS839393) used at 1 ug/ml to detect target protein.)
Western Blot (WB) FER1L3.

Rabbit polyclonal FER1L3 antibody.

Biological Significance: Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Immunogen: FER1L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing FER1L3 are readily searchable from our website. Different antibodies against the same target such as FER1L3 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions