Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-FKSG24 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
 • anti-FUBP3 antibody blog
 • anti-ROPN1 antibody blog
 • anti-ASAH2 antibody blog
 • anti-PGR antibody blog
 • anti-NOTCH3 antibody blog
 • anti-FYB antibody blog
 • anti-p53 antibody blog
 • anti-ZBTB7B antibody blog
 • anti-HLA-DQA1 antibody blog
 • anti-IL17A antibody blog
 • anti-STRADB antibody blog
 • anti-CEP57 antibody blog
 • anti-CYP26A1 antibody blog
 • anti-NEU1 antibody blog
 • anti-CYTH1 antibody blog
 • anti-AURKA antibody blog
 • anti-EBI3 antibody blog
 • anti-CCL11 antibody blog
 • anti-NGF antibody blog
 • anti-SUGP2 antibody blog
Blog Categories separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
Our Best Sellers moreseparator
 • Cytomegalovirus pp52 (UL44) (CMV pp52) Recombinant Protein
 • CD33 Antibody
 • Neisseria gonorrhoeae Antibody
 • 2-oxoisovalee dehydrogenase subunit alpha, mitochondrial (BC... ELISA Kit
 • cathepsin L1 (CTSL1) ELISA Kit
 • Pro-Matrix Metalloproteinase 9 (PRO MMP-9) Western Blot Control
 • A-agglutinin anchorage subunit (AGA1), partial Recombinant Protein
 • Interleukin 17A (IL-17A) ELISA Kit
 • DnaJC3 Blocking Peptide
 • DnaJ homolog subfamily B member 1 protein (DNAJB1) Recombinant Protein
 • Mucin-7 (MUC7) ELISA Kit
 • urocanase domain containing 1 (UROC1) ELISA Kit
 • Goat Anti-Human kappa (kappa chain specific) Secondary Antibody
 downarrow more ...

anti-FKSG24 antibody product blog

Posted on 2015-10-12 00:30:46 by mybiosource_staff
Share it on ...     
Tags: Antibody; Polyclonal Antibody; FKSG24; anti-FKSG24 antibody;
The FKSG24 mpv17l2 (Catalog #MBS5302490) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKSG24 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s FKSG24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the FKSG24 mpv17l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The FKSG24 mpv17l2 product has the following accession number(s) (GI #16902312) (NCBI Accession #AAL30173.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:

Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the FKSG24 antibody with the following immunoassay(s):
Western Blot (WB) (FKSG24 antibody (MBS5302490) used at 1 ug/ml to detect target protein.)
Western Blot (WB) FKSG24.

Rabbit polyclonal FKSG24 antibody raised against the N terminal of FKSG24.

Biological Significance: FKSG24 is a multi-pass membrane proteinPotential. It belongs to the peroxisomal membrane protein PXMP2/4 family. The exact function of FKSG24 remains unknown. Immunogen: FKSG24 antibody was raised using the N terminal of FKSG24 corresponding to a region with amino acids PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing FKSG24 are readily searchable from our website. Different antibodies against the same target such as FKSG24 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. The following patways have been known to be associated with this gene.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions