Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-FKSG24 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-OPRM1 antibody blog
 • anti-CAMK2A antibody blog
 • anti-CASP9 antibody blog
 • anti-TNIP2 antibody blog
 • anti-HSD17b12 antibody blog
 • anti-MCP4 antibody blog
 • anti-ZBED1 antibody blog
 • anti-AFF1 antibody blog
 • anti-FOXO6 antibody blog
 • anti-IAP antibody blog
 • anti-ALOX15B antibody blog
 • anti-SLK1 antibody blog
 • anti-immunoglobulin kappa variable 1-5 antibody blog
 • anti-Lef1 antibody blog
 • anti-RSPO1 antibody blog
 • anti-DEAF1 antibody blog
 • anti-CYP51A1 antibody blog
 • anti-CD177 antibody blog
 • anti-VPS54 antibody blog
 • anti-PLS3 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • Telomerase (TE) ELISA Kit
 • Monoamine Oxidase A (MAOA) Antibody
 • CALML3 Antibody
 • COL1alpha2 ELISA Kit
 • adenosine deaminase (ADA) ELISA Kit
 • JAGGED2 Antibody
 • Acinetobacter baumannii (strain ATCC 17978 - NCDC KC 755) Ou... Recombinant Protein
 • Interleukin 21 (IL21) ELISA Kit
 • Helicobacter pylori (H. pylori) (Strain 43504) Native Protein
 • Tetranectin (CLEC3B) ELISA Kit
 • interleukin 17A (IL17A) ELISA Kit
 • PCDHGC5 Antibody
 • chromosome 1 open reading frame 57 (NTPCR) Antibody
 • Inter Alpha-Globulin Inhibitor H3 (ITIH3) ELISA Kit
 downarrow more ...
separator

anti-FKSG24 antibody product blog

separator
Posted on 2015-10-12 00:30:46 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; FKSG24; anti-FKSG24 antibody;
separator
The FKSG24 mpv17l2 (Catalog #MBS5302490) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKSG24 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s FKSG24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the FKSG24 mpv17l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The FKSG24 mpv17l2 product has the following accession number(s) (GI #16902312) (NCBI Accession #AAL30173.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the FKSG24 antibody with the following immunoassay(s):
Western Blot (WB) (FKSG24 antibody (MBS5302490) used at 1 ug/ml to detect target protein.)
Western Blot (WB) FKSG24.

Rabbit polyclonal FKSG24 antibody raised against the N terminal of FKSG24.

Biological Significance: FKSG24 is a multi-pass membrane proteinPotential. It belongs to the peroxisomal membrane protein PXMP2/4 family. The exact function of FKSG24 remains unknown. Immunogen: FKSG24 antibody was raised using the N terminal of FKSG24 corresponding to a region with amino acids PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing FKSG24 are readily searchable from our website. Different antibodies against the same target such as FKSG24 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. The following patways have been known to be associated with this gene.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions