anti-GH2 antibody product blog
Tags: Antibody; Growth Hormone 2; GH2; Polyclonal Antibody; anti-GH2 antibody;
The GH2 gh2 (Catalog #MBS839207) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s Growth Hormone 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the GH2 gh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The GH2 gh2 product has the following accession number(s) (GI #18088461) (NCBI Accession #AAH20760.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Growth Hormone 2 antibody with the following immunoassay(s):
Western Blot (WB) (Growth Hormone 2 antibody (MBS839207) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal Growth Hormone 2 antibody raised against the middle region of GH2.
Biological Significance: GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency. Cross-Reactivity: Human
Immunogen: Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing GH2 are readily searchable from our website. Different antibodies against the same target such as GH2 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. GH2 also interacts with the following gene(s): GHR, JAK2, PRLR, STAT5B. Silver-Russell Syndrome are some of the diseases may be linked to Growth Hormone 2 antibody. Embryonic Tissue, Pituitary Gland, Placenta, Vascular tissues are correlated with this protein. The following patways have been known to be associated with this gene.