anti-Hif3a antibody product blog
Tags: Antibody; Polyclonal Antibody; anti-HIF3A antibody; HIF3A; Hypoxia Inducible Factor 2a;
The Hif3a hif3a (Catalog #MBS622976) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha, HIF-2-alpha, HIF2-alpha, Hif2a, Endothelial PAS Domain-containing Protein 1, Endothelial PAS Domain Protein 1, Epas1, EPAS-1, HLF) reacts with Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Hypoxia Inducible Factor 2a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC).Suitable for use in Western Blot and Immunohistochemistry.
Dilution: Western Blot: 1ug/ml
Immunohistochemistry (Paraffin and Formalin): 0.5-1ug/ml. Researchers should empirically determine the suitability of the Hif3a hif3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The Hif3a hif3a product has the following accession number(s) (GI #11968112) (NCBI Accession #NP_071973.1) (Uniprot Accession #Q9JHS2). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the induction of oxygen regulated genes. HIF-2 alpha binds to a specific core DNA sequence within the hypoxia response element of target gene promoters.
Immunogen: Synthetic peptide corresponding to aa202-240, YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD to rat Hypoxia-inducible factor-2 alpha. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Hif3a are readily searchable from our website. Different antibodies against the same target such as Hif3a may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Cardiovascular Diseases, Congenital Abnormalities, Heart Diseases, Hypertension, Inflammation, Kidney Diseases, Liver Diseases, Nervous System Diseases, Prenatal Exposure Delayed Effects, Spinal Cord Diseases are some of the diseases may be linked to Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha, HIF-2-alpha, HIF2-alpha, Hif2a, Endothelial PAS Domain-containing Protein 1, Endothelial PAS Domain Protein 1, Epas1, EPAS-1, HLF). Hif3a also interacts with the following gene(s): Arnt, Epas1, Epo, Hif1a, Vegfa, Vhl.