anti-IFN Gamma R2 antibody product blog
Tags: Antibody; Polyclonal Antibody; IFN Gamma R2; anti-IFN Gamma R2 antibody;
The IFN Gamma R2 ifngr2 (Catalog #MBS5300624) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s IFN Gamma R2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the IFN Gamma R2 ifngr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The IFN Gamma R2 ifngr2 product has the following accession number(s) (GI #47419934) (NCBI Accession #NP_005525.2). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the IFN Gamma R2 antibody with the following immunoassay(s):
Western Blot (WB) (IFN Gamma R2 antibody (MBS5300624) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal IFN Gamma R2 antibody.
Biological Significance: IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. Cross-Reactivity: Human
Immunogen: IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing IFN Gamma R2 are readily searchable from our website. Different antibodies against the same target such as IFN Gamma R2 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. IFN Gamma R2 also interacts with the following gene(s): IFNGR1, IL12A, JAK1, JAK2. Breast Neoplasms, Carcinoma, Hepatocellular, Cardiovascular Diseases, Hepatitis, Inflammation, Liver Diseases, Mycobacterium Infections, Nontuberculous, Necrosis, Neoplasms, Experimental, Nervous System Diseases are some of the diseases may be linked to IFN Gamma R2 antibody. Blood, Brain, Kidney, Liver, Lymph, Muscle, Prostate, Skin, Thyroid, Vascular tissues are correlated with this protein. The following patways have been known to be associated with this gene.