Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-Jph2 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-CRADD antibody blog
 • anti-CTF1 antibody blog
 • anti-NR5A1 antibody blog
 • anti-MAP2K4 antibody blog
 • anti-pax-6B antibody blog
 • anti-MGAT1 antibody blog
 • anti-PAWR antibody blog
 • anti-QRFPR antibody blog
 • anti-Irak1bp1 antibody blog
 • anti-UBB antibody blog
 • anti-SLC25A37 antibody blog
 • anti-LCP1 antibody blog
 • anti-APOA1 antibody blog
 • anti-TrkB antibody blog
 • anti-KRAS-2B antibody blog
 • anti-PAX8 antibody blog
 • anti-EIF1 antibody blog
 • anti-ST14 antibody blog
 • anti-ACOX1 antibody blog
 • anti-UBE2H antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • DR3 Antibody
 • Positive Control Set (SS-A, SS-B, Sm, RNP, Scl-70,Jo-1) Antibody
 • E Coli HCP Antibody
 • Interleukin 18 (IL-18) ELISA Kit
 • PKC Beta 1 IgG fraction (PRKCB) Antibody
 • BCL-2 (pS70) (BCL-2 (pS70) ) Antibody
 • CRISPLD2 Antibody
 • H3-K56 (H3K56me3) Antibody
 • Neurogenic locus notch homolog protein 1 (Notch1) ELISA Kit
 • cross linked N-telopeptide of type I  collagen, NTX ELISA Kit
 • Calprotectin L1 Antibody
 • Calnexin- ER Marker Antibody
 • Lipolysis-activating peptide 1-alpha chain (BoiLVP1-alpha) Recombinant Protein
 • Human Fibronectin (FN1) Antibody
 downarrow more ...
separator

anti-Jph2 antibody product blog

separator
Posted on 2016-01-22 23:25:18 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; JPH2; junctophilin 2; anti-JPH2 antibody;
separator
The Jph2 jph2 (Catalog #MBS5300713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Junctophilin 2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Junctophilin 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the Jph2 jph2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The Jph2 jph2 product has the following accession number(s) (GI #326633194) (NCBI Accession #NP_001192005.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Junctophilin 2 antibody with the following immunoassay(s):
Western Blot (WB) (Junctophilin 2 antibody (MBS5300713) used at 1 ug/ml to detect target protein.)
Western Blot (WB) Jph2.

Rabbit polyclonal Junctophilin 2 antibody raised against the middle region of JPH2.

Biological Significance: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. Immunogen: Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Jph2 are readily searchable from our website. Different antibodies against the same target such as Jph2 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Embryonic Tissue, Heart, Muscle, Prostate tissues are correlated with this protein. Jph2 also interacts with the following gene(s): Jph1, Ryr1, Ryr3. Arrhythmias, Cardiac, Atrial Fibrillation, Cardiomyopathies, Cardiomyopathy, Hypertrophic, Death, Sudden, Cardiac, Disease Models, Animal, Heart Diseases, Hyperplasia, Sarcoma, Uterine Neoplasms are some of the diseases may be linked to Junctophilin 2 antibody.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions