Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-Jph2 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-IRAK4 antibody blog
 • anti-FANCG antibody blog
 • anti-PDGFRB antibody blog
 • anti-CCR6 antibody blog
 • anti-PI4KB antibody blog
 • anti-EME1 antibody blog
 • anti-ABCD1 antibody blog
 • anti-GLP1R antibody blog
 • anti-SSX1 antibody blog
 • anti-EDN1 antibody blog
 • anti-TBRG1 antibody blog
 • anti-FBXL12 antibody blog
 • anti-Methadol antibody blog
 • anti-CAT antibody blog
 • anti-INA antibody blog
 • anti-CXCR5 antibody blog
 • anti-IGFBPL1 antibody blog
 • anti-FAM13A antibody blog
 • anti-TGFBR1 antibody blog
 • anti-KLK4 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • CD44 Antibody
 • BAD Antibody
 • b2-Microglobulin (HLA-G) Antibody
 • Cannabinoid Receptor 2 (CNR2) Peptide
 • N-acetylgalactosamine-6-sul fatase (GALNS) Antibody
 • Thymosin Beta 4 (Tb4) Antibody
 • FMOD ELISA Kit
 • Glucose 6 Phosphate (G6P) ELISA Kit
 • MBD2 Antibody
 • Myelin expression factor 2 (MYEF2) Antibody
 • RAB27A Recombinant Protein
 • Retinoid X Receptor Alpha (RXRa) ELISA Kit
 • soluble receptor activator ofnuclear factor-kB ligand (sRANK... ELISA Kit
 • FOXO3 - FOXO3A Antibody
 downarrow more ...
separator

anti-Jph2 antibody product blog

separator
Posted on 2016-01-22 23:25:18 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; JPH2; junctophilin 2; anti-JPH2 antibody;
separator
The Jph2 jph2 (Catalog #MBS5300713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Junctophilin 2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Junctophilin 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the Jph2 jph2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The Jph2 jph2 product has the following accession number(s) (GI #326633194) (NCBI Accession #NP_001192005.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Junctophilin 2 antibody with the following immunoassay(s):
Western Blot (WB) (Junctophilin 2 antibody (MBS5300713) used at 1 ug/ml to detect target protein.)
Western Blot (WB) Jph2.

Rabbit polyclonal Junctophilin 2 antibody raised against the middle region of JPH2.

Biological Significance: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. Immunogen: Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Jph2 are readily searchable from our website. Different antibodies against the same target such as Jph2 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Embryonic Tissue, Heart, Muscle, Prostate tissues are correlated with this protein. Jph2 also interacts with the following gene(s): Jph1, Ryr1, Ryr3. Arrhythmias, Cardiac, Atrial Fibrillation, Cardiomyopathies, Cardiomyopathy, Hypertrophic, Death, Sudden, Cardiac, Disease Models, Animal, Heart Diseases, Hyperplasia, Sarcoma, Uterine Neoplasms are some of the diseases may be linked to Junctophilin 2 antibody.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions