Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-Jph2 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-RAB26 antibody blog
 • anti-DHX58 antibody blog
 • anti-CLIC2 antibody blog
 • anti-GDF1 antibody blog
 • anti-CBX3 antibody blog
 • anti-CTRP2 antibody blog
 • anti-DCN antibody blog
 • anti-BTG4 antibody blog
 • anti-SERPINA6 antibody blog
 • anti-TIMP1 antibody blog
 • anti-CASP3 antibody blog
 • anti-BDNF antibody blog
 • anti-NIPA antibody blog
 • anti-HLA-A antibody blog
 • anti-NOD1 antibody blog
 • anti-GANC antibody blog
 • anti-PlGF antibody blog
 • anti-PITRM1 antibody blog
 • anti-ARF1 antibody blog
 • anti-IgG (H&L) antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • INF2 cDNA Clone
 • cat eye syndrome chromosome region, candidate 9 (CECR9) ELISA Kit
 • Ubinuclein 1 (UBN1) Antibody
 • QuickTiter HIV Lentivirus (p24 ELISA) Quantitation Kit
 • B-cell CLL-Lymphoma 10 (BCL10) Recombinant Protein
 • E-tag Antibody
 • Alpha Fetoprotein (AFP) Antibody
 • Vesicular, overexpressed in cancer, prosurvival protein 1 (V... Recombinant Protein
 • p21-Activating Kinase 2 Antibody
 • eNOS Antibody
 • Factor V total antigen assay (F5) ELISA Kit
 • A Disintegrin and Metalloproteinase With Thrombospondin 1 (A... ELISA Kit
 • HMGB1 Blocking Peptide
 • Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit
 downarrow more ...
separator

anti-Jph2 antibody product blog

separator
Posted on 2016-01-22 23:25:18 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; JPH2; junctophilin 2; anti-JPH2 antibody;
separator
The Jph2 jph2 (Catalog #MBS5300713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Junctophilin 2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Junctophilin 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the Jph2 jph2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The Jph2 jph2 product has the following accession number(s) (GI #326633194) (NCBI Accession #NP_001192005.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Junctophilin 2 antibody with the following immunoassay(s):
Western Blot (WB) (Junctophilin 2 antibody (MBS5300713) used at 1 ug/ml to detect target protein.)
Western Blot (WB) Jph2.

Rabbit polyclonal Junctophilin 2 antibody raised against the middle region of JPH2.

Biological Significance: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. Immunogen: Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Jph2 are readily searchable from our website. Different antibodies against the same target such as Jph2 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Embryonic Tissue, Heart, Muscle, Prostate tissues are correlated with this protein. Arrhythmias, Cardiac, Atrial Fibrillation, Cardiomyopathies, Cardiomyopathy, Hypertrophic, Death, Sudden, Cardiac, Disease Models, Animal, Heart Diseases, Hyperplasia, Sarcoma, Uterine Neoplasms are some of the diseases may be linked to Junctophilin 2 antibody. Jph2 also interacts with the following gene(s): Jph1, Ryr1, Ryr3.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions