anti-LOC283130 antibody product blog
Tags: Antibody; Polyclonal Antibody; LOC283130; anti-LOC283130 antibody;
The LOC283130 n/a (Catalog #MBS839764) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s LOC283130 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC).WB: 5 ug/ml
IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the LOC283130 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the LOC283130 antibody with the following immunoassay(s):
Western Blot (WB) (LOC283130 antibody (MBS839764) used at 5 ug/ml to detect target protein.)
Rabbit polyclonal LOC283130 antibody raised against the C terminal Of Loc283130.
Biological Significance: SLC25A45 belongs to the SLC25 family of mitochondrial carrier proteins. Cross-Reactivity: Human
Immunogen: LOC283130 antibody was raised using the C terminal Of Loc283130 corresponding to a region with amino acids GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing LOC283130 are readily searchable from our website. Different antibodies against the same target such as LOC283130 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.