anti-N antibody product blog
Tags: Antibody; Polyclonal Antibody; anti-N antibody;
The N n/a (Catalog #MBS839244) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s N can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the N n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the N antibody with the following immunoassay(s):
Western Blot (WB) (N antibody (MBS839244) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal N antibody.
Biological Significance: This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring which transiently binds U6 small nuclear RNAs and is involved in the general maturation of RNA in the nucleus. Cross-Reactivity: Human
Immunogen: N antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing N are readily searchable from our website. Different antibodies against the same target such as N may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.