anti-OSBPL8 antibody product blog
Tags: Antibody; Polyclonal Antibody; OSBPL8; anti-OSBPL8 antibody;
The OSBPL8 osbpl8 (Catalog #MBS838989) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s OSBPL8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the OSBPL8 osbpl8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The OSBPL8 osbpl8 product has the following accession number(s) (GI #51895890) (NCBI Accession #AAH82235.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the OSBPL8 antibody with the following immunoassay(s):
Western Blot (WB) (OSBPL8 antibody (MBS838989) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal OSBPL8 antibody raised against the N terminal of OSBPL8.
Biological Significance: OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Cross-Reactivity: Human
Immunogen: OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing OSBPL8 are readily searchable from our website. Different antibodies against the same target such as OSBPL8 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. OSBPL8 also interacts with the following gene(s): C21orf33, RUNX2, THBS4. Blood, Brain, Heart, Kidney, Liver, Nerve tissues are correlated with this protein.