anti-PIP3-E antibody product blog
Tags: Antibody; Polyclonal Antibody; PIP3-E; anti-PIP3-E antibody;
The PIP3-E n/a (Catalog #MBS5303083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s PIP3-E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the PIP3-E n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the PIP3-E antibody with the following immunoassay(s):
Western Blot (WB) (PIP3-E antibody (MBS5303083) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal PIP3-E antibody raised against the middle region of PIP3-E.
Biological Significance: PIP3-E enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner. Cross-Reactivity: Human
Immunogen: PIP3-E antibody was raised using the middle region of PIP3-E corresponding to a region with amino acids IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing PIP3-E are readily searchable from our website. Different antibodies against the same target such as PIP3-E may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.