Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-pyrG antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-ICA1 antibody blog
 • anti-RRN3 antibody blog
 • anti-KBTBD3 antibody blog
 • anti-GS antibody blog
 • anti-SYK antibody blog
 • anti-DPAGT1 antibody blog
 • anti-SSX2 antibody blog
 • anti-TNIK antibody blog
 • anti-POTEE antibody blog
 • anti-NFKBIA antibody blog
 • anti-SLP (C.difficile) antibody blog
 • anti-NGB antibody blog
 • anti-IL2RG antibody blog
 • anti-LEDGF antibody blog
 • anti-Hif1a antibody blog
 • anti-MAG antibody blog
 • anti-PHF5A antibody blog
 • anti-NOTCH1 antibody blog
 • anti-VCPIP1 antibody blog
 • anti-AKT2 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • Tsc2 Antibody
 • GRN ELISA Kit
 • Nicotine (NCT) ELISA Kit
 • peptidylprolyl isomerase A (cyclophilin A) (PPIA) ELISA Kit
 • Hydroxymethylglutaryl-CoA synthase (Hmgcs1) Antibody
 • CCR5 Antibody
 • M TLR4 Blocking Peptide
 • Vascular Endothelial cell Growth Factor B (VEGF-B) ELISA Kit
 • GTPase KRas (Kras) Recombinant Protein
 • Interleukin 16, IL-16 ELISA Kit
 • Angiopoietin 1 (ANGPT1) ELISA Kit
 • Adeno-Associated Virus 2 Replicase Antibody
 • Vascular Cell Adhesion Molecule 1 (VCAM-1) ELISA Kit
 • Resolvin D4 (RvD4) ELISA Kit
 downarrow more ...
separator

anti-pyrG antibody product blog

separator
Posted on 2016-01-13 00:06:57 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; pyrG; CTP synthase; anti-pyrG antibody;
separator
The Ctp Synthase pyrg (Catalog #MBS5302455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ctp Synthase antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Ctp Synthase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC).
WB: 5 ug/ml
IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the Ctp Synthase pyrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The Ctp Synthase pyrg product has the following accession number(s) (GI #332179422) (NCBI Accession #AEE15111.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Ctp Synthase antibody with the following immunoassay(s):
Western Blot (WB) (Ctp Synthase antibody (MBS5302455) used at 5 ug/ml to detect target protein.)
Western Blot (WB) Ctp Synthase.

Immunohistochemistry (IHC) (Ctp Synthase antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X)
Immunohistochemistry (IHC) Ctp Synthase.

Rabbit polyclonal Ctp Synthase antibody raised against the N terminal of CTPS.

Biological Significance: The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development and tumorigenesis. Immunogen: Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids  SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Ctp Synthase are readily searchable from our website. Different antibodies against the same target such as Ctp Synthase may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions