Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-pyrG antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
 • anti-ROBO1 antibody blog
 • anti-OR4X2 antibody blog
 • anti-NRG2 antibody blog
 • anti-TNFRSF10D antibody blog
 • anti-LCN5 antibody blog
 • anti-MMP7 antibody blog
 • anti-CASP8 antibody blog
 • anti-OR1I1 antibody blog
 • anti-DOK1 antibody blog
 • anti-FXY2 antibody blog
 • anti-MATN1 antibody blog
 • anti-cerebellin 2 precursor antibody blog
 • anti-IgG (H&L) antibody blog
 • anti-PSMC2 antibody blog
 • anti-mitogen-activated protein kinase kinase kinase 7 interacting protein 1 antibody blog
 • anti-CYB5B antibody blog
 • anti-GHRHR antibody blog
 • anti-RPL36AL antibody blog
 • anti-Sirt1 antibody blog
 • anti-CHRAC1 antibody blog
Blog Categories separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
Our Best Sellers moreseparator
 • 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial (HIBCH) ELISA Kit
 • Listeria monocytogenes Antibody
 • Collagen Type VII Antibody
 • Outer membrane protein A (ompA) Recombinant Protein
 • cardiotrophin 1 (CTF1) ELISA Kit
 • MUC1 - EMA -CD227 Antibody
 • DNA (cytosine-5-) -methyltransferase 3 alpha (DNMT3A) ELISA Kit
 • Chemokine interferon-inducible protein 10 (IP-10) ELISA Kit
 • chromosome 5 open reading frame 36 (C5orf36) ELISA Kit
 • TBX2 Antibody
 • 2-amino-3-ketobutye coenzyme A ligase, mitochondrial (GCAT) ELISA Kit
 downarrow more ...

anti-pyrG antibody product blog

Posted on 2016-01-13 00:06:57 by mybiosource_staff
Share it on ...     
Tags: Antibody; Polyclonal Antibody; pyrG; CTP synthase; anti-pyrG antibody;
The Ctp Synthase pyrg (Catalog #MBS5302455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ctp Synthase antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Ctp Synthase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC).
WB: 5 ug/ml
IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the Ctp Synthase pyrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The Ctp Synthase pyrg product has the following accession number(s) (GI #332179422) (NCBI Accession #AEE15111.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:

Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Ctp Synthase antibody with the following immunoassay(s):
Western Blot (WB) (Ctp Synthase antibody (MBS5302455) used at 5 ug/ml to detect target protein.)
Western Blot (WB) Ctp Synthase.

Immunohistochemistry (IHC) (Ctp Synthase antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X)
Immunohistochemistry (IHC) Ctp Synthase.

Rabbit polyclonal Ctp Synthase antibody raised against the N terminal of CTPS.

Biological Significance: The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development and tumorigenesis. Immunogen: Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids  SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Ctp Synthase are readily searchable from our website. Different antibodies against the same target such as Ctp Synthase may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions