anti-RABGEF1 antibody product blog
Tags: Antibody; Polyclonal Antibody; anti-RABGEF1 antibody; RABGEF1;
The RABGEF1 n/a (Catalog #MBS5303218) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s RABGEF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the RABGEF1 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the RABGEF1 antibody with the following immunoassay(s):
Western Blot (WB) (RABGEF1 antibody (MBS5303218) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal RABGEF1 antibody.
Biological Significance: RABGEF1 forms a complex with rabaptin-5 that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5. Cross-Reactivity: Human
Immunogen: RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing RABGEF1 are readily searchable from our website. Different antibodies against the same target such as RABGEF1 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.