anti-RIC8B antibody product blog
Tags: Antibody; Polyclonal Antibody; RIC8B; anti-RIC8B antibody;
The RIC8B ric8b (Catalog #MBS5301124) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s RIC8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the RIC8B ric8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The RIC8B ric8b product has the following accession number(s) (GI #71051998) (NCBI Accession #AAH34220.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the RIC8B antibody with the following immunoassay(s):
Western Blot (WB) (RIC8B antibody (MBS5301124) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal RIC8B antibody.
Biological Significance: RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction. Cross-Reactivity: Human, Mouse, Rat
Immunogen: RIC8B antibody was raised using a synthetic peptide corresponding to a region with amino acids HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing RIC8B are readily searchable from our website. Different antibodies against the same target such as RIC8B may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Bone, Brain, Embryonic Tissue, Kidney, Testis tissues are correlated with this protein. RIC8B also interacts with the following gene(s): RTP1.