Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-RP11-269F19.9 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-ERG antibody blog
 • anti-RNASEL antibody blog
 • anti-KCE1L antibody blog
 • anti-WDR23 antibody blog
 • anti-LEPR antibody blog
 • anti-GRAK antibody blog
 • anti-SCGB1C1 antibody blog
 • anti-PEPD antibody blog
 • anti-SELE antibody blog
 • anti-SERPINC1 antibody blog
 • anti-EIF5B antibody blog
 • anti-CYP46A1 antibody blog
 • anti-MSH6 antibody blog
 • anti-RHPN1 antibody blog
 • anti-SRMS antibody blog
 • anti-HRAS antibody blog
 • anti-SLC23A1 antibody blog
 • anti-RGS10 antibody blog
 • anti-F2R antibody blog
 • anti-ETFB antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • TCRB Antibody
 • sICAM-1-CD54 ELISA Kit
 • NADPH oxidase 4 (Nox4) Recombinant Protein
 • Podocin (PDCN) ELISA Kit
 • Id3 Antibody
 • S100 Calcium Binding Protein ELISA Kit
 • IRTKS Antibody
 • leptin ELISA Kit
 • Killer Cell Immunoglobulin-Like Receptor (KIR3DL1) Recombinant Protein
 • Mucin-5 Subtype Ac (MUC5AC) ELISA Kit
 • Diphosphoinositol polyphosphate phosphohydrolase DDP1 Recombinant Protein
 • Defensin Alpha 3 (DEFa3) Antibody
 • Serum Amyloid A (SAA) ELISA Kit
 • Integrin Alpha 5 (ITGalpha5) ELISA Kit
 downarrow more ...
separator

anti-RP11-269F19.9 antibody product blog

separator
Posted on 2016-01-03 06:40:24 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; RP11-269F19.9; anti-RP11-269F19.9 antibody;
separator
The RP11-269F19.9 n/a (Catalog #MBS839704) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RP11-269F19.9 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s RP11-269F19.9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the RP11-269F19.9 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the RP11-269F19.9 antibody with the following immunoassay(s):
Western Blot (WB) (RP11-269F19.9 antibody (MBS839704) used at 1 ug/ml to detect target protein.)
Western Blot (WB) RP11-269F19.9.

Rabbit polyclonal RP11-269F19.9 antibody raised against the N terminal Of Rp11-269F19.9.

Biological Significance: RP11-269F19.9 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of RP11-269F19.9 remains unknown. Immunogen: RP11-269F19.9 antibody was raised using the N terminal Of Rp11-269F19.9 corresponding to a region with amino acids RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing RP11-269F19.9 are readily searchable from our website. Different antibodies against the same target such as RP11-269F19.9 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions