Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-SECTM1 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-ompC antibody blog
 • anti-FZD6 antibody blog
 • anti-PRDX4 antibody blog
 • anti-Olfm1 antibody blog
 • anti-ST6GAL2 antibody blog
 • anti-HMBOX1 antibody blog
 • anti-CLCF1 antibody blog
 • anti-HDAC2 antibody blog
 • anti-LGALS3BP antibody blog
 • anti-C15orf40 antibody blog
 • anti-NF-Y antibody blog
 • anti-IA-6 antibody blog
 • anti-MICU2 antibody blog
 • anti-SSTR5 antibody blog
 • anti-A2M antibody blog
 • anti-DGKG antibody blog
 • anti-EPB41L4A antibody blog
 • anti-GJB5 antibody blog
 • anti-APAF 1 antibody blog
 • anti-GAK antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • Factor Xa, BEGR Protein
 • CCL19 Recombinant Protein
 • growth differentiation factor 15 (GDF15) ELISA Kit
 • CYP2C8 + CYP2C9 + CYP2C19 (CYP2C8 - CYP2C9 - CYP2C19 ) Antibody
 • H3 (A-Shangdong-9-93) (H3N2) Antibody
 • Wilms tumor protein homolog (Wt1) Recombinant Protein
 • Amiloride-sensitive sodium channel subunit alpha (SCNN1A) ELISA Kit
 • PDGF (PDGFB) Antibody
 • PRL ELISA Kit
 • ST6 (alpha-N-acetyl-neuraminyl- 2, 3-beta-galactosyl-1, 3)-N-... Antibody
 • Dengue Virus IgG (DENV-IgG) ELISA Kit
 • CD56 Antibody
 • NLRP3 Antibody
 • Anthranilate synthase component II, pyocyanin specific (phnB... Recombinant Protein
 downarrow more ...
separator

anti-SECTM1 antibody product blog

separator
Posted on 2017-03-03 03:35:39 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; SECTM1; anti-SECTM1 antibody;
separator
The SECTM1 sectm1b (Catalog #MBS177755) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SECTM1 Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s SECTM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
Western Blot

Concentration: 0.1-0.5ug/ml
Tested Species: Ms

Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the SECTM1 sectm1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The SECTM1 sectm1b product has the following accession number(s) (GI #25009252) (NCBI Accession #Q9JL59.1) (Uniprot Accession #Q9JL59). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Anti-SECTM1 Antibody with the following immunoassay(s):
Western Blot (WB) (Anti- SECTM1 Picoband antibody, Western blotting
All lanes: Anti SECTM1 at 0.5ug/ml)
Western Blot (WB) SECTM1.

Description: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(SECTM1) detection. Tested with WB in Mouse.

Background: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK).
Ig Type: Rabbit IgG. Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing SECTM1 are readily searchable from our website. Different antibodies against the same target such as SECTM1 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Intestine, Lung tissues are correlated with this protein.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions