Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-SECTM1 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
 • anti-CORO1C antibody blog
 • anti-SDF4 antibody blog
 • anti-GPD1 antibody blog
 • anti-NEK2 antibody blog
 • anti-STAT2 antibody blog
 • anti-NPFF2 antibody blog
 • anti-hsp70-3 antibody blog
 • anti-PDP antibody blog
 • anti-TRAPPC13 antibody blog
 • anti-AAMP antibody blog
 • anti-inositol polyphosphate-5-phosphatase J antibody blog
 • anti-LOC100135965 antibody blog
 • anti-ITGA6 antibody blog
 • anti-GPRC5B antibody blog
 • anti-DGKZ antibody blog
 • anti-CASR antibody blog
 • anti-ARID5B antibody blog
 • anti-PSMD2 antibody blog
 • anti-CXCR3 antibody blog
 • anti-INS antibody blog
Blog Categories separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
Our Best Sellers moreseparator
 • C Terminal Telopeptide of Type I Collagen (CTX) ELISA Kit
 • IGFBP-3 Antibody
 • Chordin (CHRD) Antibody
 • E1A Binding Protein P300 (EP300) ELISA Kit
 • Metalloproteinase inhibitor 4 (TIMP4) Antibody
 • Rabbit anti pigeon IgG (heavy and light chains) Secondary Antibody
 • Succinate Dehydrogenase Complex Subunit D (SDHD) Antibody
 • Agrin (AGRN) Recombinant Protein
 • Guanylin (GUCA2A) ELISA Kit
 • AKT1-T450 Antibody
 • ANG-R-Tie1 ELISA Kit
 • DNA-directed RNA polymerase III subunit RPC1 (POLR3A) Recombinant Protein
 • C1r (Clr) ELISA Kit
 • Beclin1 (BECN1) ELISA Kit
 downarrow more ...

anti-SECTM1 antibody product blog

Posted on 2017-03-03 03:35:39 by mybiosource_staff
Share it on ...     
Tags: Antibody; Polyclonal Antibody; SECTM1; anti-SECTM1 antibody;
The SECTM1 sectm1b (Catalog #MBS177755) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SECTM1 Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s SECTM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
Western Blot

Concentration: 0.1-0.5ug/ml
Tested Species: Ms

Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the SECTM1 sectm1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The SECTM1 sectm1b product has the following accession number(s) (GI #25009252) (NCBI Accession #Q9JL59.1) (Uniprot Accession #Q9JL59). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:

Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Anti-SECTM1 Antibody with the following immunoassay(s):
Western Blot (WB) (Anti- SECTM1 Picoband antibody, MBS177755, Western blotting
All lanes: Anti SECTM1 (MBS177755) at 0.5ug/ml
WB : HEPA Whole Cell Lysate at 40ug
Predicted bind size: 23KD
Observed bind size: 23KD )
Western Blot (WB) SECTM1.

Description: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(SECTM1) detection. Tested with WB in Mouse.

Background: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK).
Ig Type: Rabbit IgG. Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing SECTM1 are readily searchable from our website. Different antibodies against the same target such as SECTM1 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Intestine, Lung tissues are correlated with this protein.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions