Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-SLC15A4 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-GSR antibody blog
 • anti-TFF3 antibody blog
 • anti-IgG antibody blog
 • anti-CD64 antibody blog
 • anti-IgG antibody blog
 • anti-SOCS7 antibody blog
 • anti-PDE5A antibody blog
 • anti-anti-Mouse IgG Fc antibody blog
 • anti-TAS2R39 antibody blog
 • anti-GYS1 antibody blog
 • anti-FTSJ1 antibody blog
 • anti-LASS5 antibody blog
 • anti-IFN-beta antibody blog
 • anti-TPSb2 antibody blog
 • anti-general transcription factor IIIC, polypeptide 5 antibody blog
 • anti-SLC1A2 antibody blog
 • anti-STAT2 antibody blog
 • anti-CXCL3 antibody blog
 • anti-CXADR antibody blog
 • anti-Plg antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • 14-3-3 EPSILON Antibody
 • Visfatin (NAMPT) Recombinant Protein
 • HSV2 Antibody
 • ADAM metallopeptidase domain 9 (meltrin gamma) (ADAM9) ELISA Kit
 • Response Gene To Complement  32 (RGC32) ELISA Kit
 • Procalcitonin (PCT) ELISA Kit
 • 5-hydroxytryptamine receptor 1D (HTR1D) Recombinant Protein
 • p130Cas Antibody
 • Renin (Ren1) ELISA Kit
 • Acetyl-CoA Carboxylase (Phospho-Ser80) (ACACA) Antibody
 • Hydroxyprogesterone-17-alph a Antibody
 • Human IgG1 kappa Isotype Control Isotype Control
 • GRAP2 Recombinant Protein
 • Histone H2A.X (h2ax) Antibody
 downarrow more ...
separator

anti-SLC15A4 antibody product blog

separator
Posted on 2018-06-14 09:39:05 by mybiosource_staff
Share it on ...     
separator
separator
Tags: Antibody; Polyclonal Antibody; SLC15A4; anti-SLC15A4 antibody;
separator
The SLC15A4 slc15a4 (Catalog #MBS5300967) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC15A4 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s SLC15A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC15A4 slc15a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The SLC15A4 slc15a4 product has the following accession number(s) (GI #21717816) (NCBI Accession #NP_663623.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the SLC15A4 antibody with the following immunoassay(s):
Western Blot (WB) (SLC15A4 antibody (MBS5300967) used at 1 ug/ml to detect target protein.)
Western Blot (WB) SLC15A4.

Rabbit polyclonal SLC15A4 antibody raised against the middle region of SLC15A4.

Biological Significance: SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides. Immunogen: SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids  GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing SLC15A4 are readily searchable from our website. Different antibodies against the same target such as SLC15A4 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Blood, Brain, Heart, Intestine, Kidney, Lung, Mammary Gland, Muscle, Prostate, Thyroid tissues are correlated with this protein. Diabetes Mellitus, Hyperplasia, Inflammation, Kidney Diseases, Lupus Erythematosus, Systemic, Memory Disorders, Nephritis, Nervous System Diseases, Prostatic Neoplasms are some of the diseases may be linked to SLC15A4 antibody. The following patways have been known to be associated with this gene. SLC15A4 also interacts with the following gene(s): NOD2, RASGRP3, SLC15A3.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions