Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-SLC15A4 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
 • anti-MPG antibody blog
 • anti-JUNB antibody blog
 • anti-FABP2 antibody blog
 • anti-COL5A2 antibody blog
 • anti-AGBL3 antibody blog
 • anti-AHSA2 antibody blog
 • anti-ERVW-1 antibody blog
 • anti-NDRG1 antibody blog
 • anti-GMNN antibody blog
 • anti-PGC antibody blog
 • anti-Scnn1g antibody blog
 • anti-EDC3 antibody blog
 • anti-NCR2 antibody blog
 • anti-IgG antibody blog
 • anti-CB2 antibody blog
 • anti-Chlorpyrifos antibody blog
 • anti-TSEN2 antibody blog
 • anti-SMARCE1 antibody blog
 • anti-ENPP1 antibody blog
 • anti-BSG antibody blog
Blog Categories separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
Our Best Sellers moreseparator
 • ZNT2 (SLC30A2) Antibody
 • SNX27 cDNA Clone
 • Interleukin 8 (IL8) Antibody
 • Mannose Binding Lectin C (MBL-C) ELISA Kit
 • ARHGEF2 cDNA Clone
 • ATM Antibody
 • Karyopherin beta 1 (KPNB1) Peptide
 • A-L-Iduronidase (IDUA) ELISA Kit
 • S-Adenosyl Methionine (SAM) ELISA Kit
 • Protein NLRC5, NLRC5 ELISA Kit
 • CR1 ELISA Kit
 • Galectin-2 (LGALS2) Recombinant Protein
 • Myeloperoxidase (MPO) Antibody
 • Cardiac Troponin 1 (cTn1) ELISA Kit
 downarrow more ...

anti-SLC15A4 antibody product blog

Posted on 2018-06-14 09:39:05 by mybiosource_staff
Share it on ...     
Tags: Antibody; Polyclonal Antibody; SLC15A4; anti-SLC15A4 antibody;
The SLC15A4 slc15a4 (Catalog #MBS5300967) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC15A4 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s SLC15A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC15A4 slc15a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The SLC15A4 slc15a4 product has the following accession number(s) (GI #21717816) (NCBI Accession #NP_663623.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:

Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the SLC15A4 antibody with the following immunoassay(s):
Western Blot (WB) (SLC15A4 antibody (MBS5300967) used at 1 ug/ml to detect target protein.)
Western Blot (WB) SLC15A4.

Rabbit polyclonal SLC15A4 antibody raised against the middle region of SLC15A4.

Biological Significance: SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides. Immunogen: SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids  GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing SLC15A4 are readily searchable from our website. Different antibodies against the same target such as SLC15A4 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Blood, Brain, Heart, Intestine, Kidney, Lung, Mammary Gland, Muscle, Prostate, Thyroid tissues are correlated with this protein. Diabetes Mellitus, Hyperplasia, Inflammation, Kidney Diseases, Lupus Erythematosus, Systemic, Memory Disorders, Nephritis, Nervous System Diseases, Prostatic Neoplasms are some of the diseases may be linked to SLC15A4 antibody. SLC15A4 also interacts with the following gene(s): NOD2, RASGRP3, SLC15A3. The following patways have been known to be associated with this gene.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions