anti-SLC25A32 antibody product blog
Tags: Antibody; Polyclonal Antibody; SLC25A32; anti-SLC25A32 antibody;
The SLC25A32 n/a (Catalog #MBS839978) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A32 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s SLC25A32 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC25A32 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The SLC25A32 n/a product has the following accession number(s) (GI #649128044) (NCBI Accession #AIC57209.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Rabbit polyclonal SLC25A32 antibody raised against the middle region of SLC25A32.
Biological Significance: SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria. Cross-Reactivity: Human,Mouse,Rat
Immunogen: SLC25A32 antibody was raised using the middle region of SLC25A32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing SLC25A32 are readily searchable from our website. Different antibodies against the same target such as SLC25A32 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.