Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource  rightarrow Polyclonal Antibody Blog  rightarrow anti-TMTC1 antibody  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
 • anti-PPM1D antibody blog
 • anti-Raf1 antibody blog
 • anti-ZYG11BL antibody blog
 • anti-Photobacterium fischeri Luciferase antibody blog
 • anti-ACVR1C antibody blog
 • anti-ESRRG antibody blog
 • anti-PGE antibody blog
 • anti-AGO1 antibody blog
 • anti-ARHGDIA antibody blog
 • anti-ACVR1 antibody blog
 • anti-XRCC6 antibody blog
 • anti-AFM antibody blog
 • anti-GALK2 antibody blog
 • anti-Camk2a antibody blog
 • anti-CALR antibody blog
 • anti-HGFAC antibody blog
 • anti-RGS5 antibody blog
 • anti-CCL4 antibody blog
 • anti-Nesp2 antibody blog
 • anti-ADCY5/6 antibody blog
Blog Categories separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
Our Best Sellers moreseparator
 • hypoxia up-regulated 1 (HYOU1) ELISA Kit
 • chemokine (C-C motif) ligand 4 (CCL4) ELISA Kit
 • Diuretic Hormone (ADH) ELISA Kit
 • AMP Activated Protein Kinase 1 (PRKAA2) Antibody
 • Hyaluronan and proteoglycan link protein 1 (HAPLN1) Recombinant Protein
 • PKC-delta Protein
 • Calreticulin-3 (CALR3) Antibody
 • Myeloid cell surface antigen CD33 (CD33) Recombinant Protein
 • Acetyl Coenzyme A Carboxylase Alpha (ACACa) ELISA Kit
 • b2-Microglobulin (HLA-G) Antibody
 • Interleukin-4 protein (Il4) Recombinant Protein
 • C14orf68 Peptide
 downarrow more ...

anti-TMTC1 antibody product blog

Posted on 2015-08-13 08:57:15 by mybiosource_staff
Share it on ...     
Tags: Antibody; Polyclonal Antibody; TMTC1; anti-TMTC1 antibody;
The TMTC1 tmtc1 (Catalog #MBS839252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMTC1 antibody reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s TMTC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMTC1 tmtc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The TMTC1 tmtc1 product has the following accession number(s) (GI #301336134) (NCBI Accession #NP_001180380.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:

Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the TMTC1 antibody with the following immunoassay(s):
Western Blot (WB) (TMTC1 antibody (MBS839252) used at 1 ug/ml to detect target protein.)
Western Blot (WB) TMTC1.

Rabbit polyclonal TMTC1 antibody raised against the middle region of TMTC1.

Biological Significance: TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown. Immunogen: TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing TMTC1 are readily searchable from our website. Different antibodies against the same target such as TMTC1 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Brain, Heart, Vascular tissues are correlated with this protein.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions