anti-TSPAN5 antibody product blog
Tags: Antibody; Polyclonal Antibody; Tspan5; tetraspanin 5; anti-TSPAN5 antibody;
The TSPAN5 tspan5 (Catalog #MBS839376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s Tetraspanin 5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC).WB: 0.25 ug/ml
IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the TSPAN5 tspan5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The TSPAN5 tspan5 product has the following accession number(s) (GI #119626479) (NCBI Accession #EAX06074.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Tetraspanin 5 antibody with the following immunoassay(s):
Western Blot (WB) (Tetraspanin 5 antibody (MBS839376) used at 0.25 ug/ml to detect target protein.)
Immunohistochemistry (IHC) (Tetraspanin 5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)
Rabbit polyclonal Tetraspanin 5 antibody raised against the middle region of TSPAN5.
Biological Significance: TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Cross-Reactivity: Human, Mouse, Rat, Dog
Immunogen: Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing TSPAN5 are readily searchable from our website. Different antibodies against the same target such as TSPAN5 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Cardiovascular Diseases, Inflammation, Neoplasm Metastasis, Nervous System Diseases are some of the diseases may be linked to Tetraspanin 5 antibody. TSPAN5 also interacts with the following gene(s): TSPAN13. Blood, Bone, Brain, Embryonic Tissue, Eye, Heart, Nerve, Placenta tissues are correlated with this protein.