anti-UPF3B antibody product blog
Tags: Antibody; Polyclonal Antibody; UPF3B; anti-UPF3B antibody;
The UPF3B upf3b (Catalog #MBS5302217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s UPF3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).WB: 1 ug/ml. Researchers should empirically determine the suitability of the UPF3B upf3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The UPF3B upf3b product has the following accession number(s) (GI #111309183) (NCBI Accession #AAI21019.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the UPF3B antibody with the following immunoassay(s):
Western Blot (WB) (UPF3B antibody (MBS5302217) used at 1 ug/ml to detect target protein.)
Rabbit polyclonal UPF3B antibody.
Biological Significance: UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. Cross-Reactivity: Human
Immunogen: UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing UPF3B are readily searchable from our website. Different antibodies against the same target such as UPF3B may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. The following patways have been known to be associated with this gene. UPF3B also interacts with the following gene(s): CASC3, EIF4A3, MAGOH, RNPS1, SMG1, SMG5, UPF1, UPF2. Blood, Bone, Brain, Connective Tissue, Embryonic Tissue, Eye, Heart, Kidney tissues are correlated with this protein. Chromosome Aberrations, Cognition Disorders, Heart Diseases, Memory Disorders, Mental Retardation, X-Linked are some of the diseases may be linked to UPF3B antibody.