• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

anti-Beta Tubulin 2A antibody product blog

Tags: Antibody; Polyclonal Antibody; Beta Tubulin 2A; anti-Beta Tubulin 2A antibody;

     The Beta Tubulin 2A n/a (Catalog #MBS5301968) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Beta Tubulin 2A antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. MyBioSource\'s Beta Tubulin 2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the Beta Tubulin 2A n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Beta Tubulin 2A antibody with the following immunoassay(s):
Western Blot (WB) (Beta Tubulin 2A antibody (MBS5301968) used at 1 ug/ml to detect target protein.)
Western Blot (WB) Beta Tubulin 2A.

Rabbit polyclonal Beta Tubulin 2A antibody raised against the N terminal of TUBB2A.

Biological Significance: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Immunogen: Beta Tubulin 2A antibody was raised using the N terminal of TUBB2A corresponding to a region with amino acids MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Beta Tubulin 2A are readily searchable from our website. Different antibodies against the same target such as Beta Tubulin 2A may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
1146 - Table 'mbsds_xtra.countries' doesn't exist

select countries_id, countries_name from countries order by countries_name

[TEP STOP]