• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

anti-C10ORF83 antibody product blog

Tags: Antibody; Polyclonal Antibody; C10ORF83; anti-C10ORF83 antibody;

     The C10ORF83 morn4 (Catalog #MBS5300155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C10ORF83 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s C10ORF83 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the C10ORF83 morn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The C10ORF83 morn4 product has the following accession number(s) (GI #119570296) (NCBI Accession #EAW49911.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the C10ORF83 antibody with the following immunoassay(s):
Western Blot (WB) (C10ORF83 antibody (MBS5300155) used at 1 ug/ml to detect target protein.)
Western Blot (WB) C10ORF83.

Rabbit polyclonal C10ORF83 antibody raised against the middle region of C10Orf83.

Biological Significance: The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated. Immunogen: C10ORF83 antibody was raised using the middle region of C10Orf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing C10ORF83 are readily searchable from our website. Different antibodies against the same target such as C10ORF83 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Neurotoxicity Syndromes, Poisoning are some of the diseases may be linked to C10ORF83 antibody. Eye tissues are correlated with this protein. C10ORF83 also interacts with the following gene(s): MYO3A, MYO3B.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
1146 - Table 'mbsds_xtra.countries' doesn't exist

select countries_id, countries_name from countries order by countries_name

[TEP STOP]