• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

anti-RP11-269F19.9 antibody product blog

Tags: Antibody; Polyclonal Antibody; RP11-269F19.9; anti-RP11-269F19.9 antibody;

     The RP11-269F19.9 n/a (Catalog #MBS839704) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RP11-269F19.9 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. MyBioSource\'s RP11-269F19.9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB).
WB: 1 ug/ml. Researchers should empirically determine the suitability of the RP11-269F19.9 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the RP11-269F19.9 antibody with the following immunoassay(s):
Western Blot (WB) (RP11-269F19.9 antibody (MBS839704) used at 1 ug/ml to detect target protein.)
Western Blot (WB) RP11-269F19.9.

Rabbit polyclonal RP11-269F19.9 antibody raised against the N terminal Of Rp11-269F19.9.

Biological Significance: RP11-269F19.9 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of RP11-269F19.9 remains unknown. Immunogen: RP11-269F19.9 antibody was raised using the N terminal Of Rp11-269F19.9 corresponding to a region with amino acids RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing RP11-269F19.9 are readily searchable from our website. Different antibodies against the same target such as RP11-269F19.9 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
1146 - Table 'mbsds_xtra.countries' doesn't exist

select countries_id, countries_name from countries order by countries_name

[TEP STOP]